PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 108680
Common NameMICPUN_108680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas
Family SBP
Protein Properties Length: 389aa    MW: 41157.8 Da    PI: 8.342
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
108680genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP49.98.4e-16173247177
             --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
     SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
             +C v++C +   +   y rr++ C+ h  a +v+ +g   rfCq+Cs f  +s+fD ++++Cr+ L  +n+ rr+++
  108680 173 RCTVDNCGEPCVS--VYCRRYHTCREHIGALHVVRNGADVRFCQRCSSFQPISDFDGDRHTCRDALRAYNSARREAR 247
             69*****998755..6*******************************************************999765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.9E-15169233IPR004333Transcription factor, SBP-box
PROSITE profilePS5114116.477171246IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.72E-15172247IPR004333Transcription factor, SBP-box
PfamPF031103.0E-20174245IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MLTHPNNTGA AGAQAKPPRR ARANAKDGEG IVPSVGKAGF QLKAVGTRPI RMSHVSSTSH  60
HSLASLAHAK EEDHAEDDNE ELSPEREQPD ASLGTVVADA SHPDTRETTE TPNLEPNDSD  120
ASRPVPAGES QRGGNQLIRM SPRAEEPDAA LEVHASHRAP PELPPSSPGG TIRCTVDNCG  180
EPCVSVYCRR YHTCREHIGA LHVVRNGADV RFCQRCSSFQ PISDFDGDRH TCRDALRAYN  240
SARREARKTN KYKRKEAAAA AGDADGALKR GAKGAKKTRT EPAPSSKNAN DAPANAAFGV  300
DNRAIEIYRA TMNALQATRA APAPGAPPPP AATMTQLDAM RMMAASAGNQ AAALTGNGGD  360
GGAQMLRMMQ FMNAAWLQWC ANVKSQGP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00060PBMTransfer from AT3G60030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0013280.0CP001328.1 Micromonas sp. RCC299 chromosome 7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002504061.10.0predicted protein
TrEMBLC1EB450.0C1EB45_MICSR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.12e-11squamosa promoter-binding protein-like 12
Publications ? help Back to Top
  1. Worden AZ, et al.
    Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas.
    Science, 2009. 324(5924): p. 268-72
    [PMID:19359590]